Genome 540 Homework Assignment 3

Due Saturday Jan. 28

  1. Write a program that reads in three input protein sequences (from a FASTA file), together with a score matrix, creates the edit graph for the three sequences, and outputs this graph in a file in the appropriate input format for the WDAG program you wrote in part 1 of homework 2. Recall that, in the edit graph, vertices correspond to triples (i,j,k) where 0 <= i <= n1, 0 <= j <= n2, and 0 <= k <= n3, where n1, n2 and n3 are the lengths of the three sequences. There is an edge from (i,j,k) to (i',j',k') whenever i' = i or i+1, j' = j or j+1, and k' = k or k+1, and at least one of the equalities i'=i, j'=j, and k'=k is false. The label you should attach to an edge is the corresponding column of aligned residues & gap characters -- except that you can write it horizontally instead of vertically. For example, the label associated to the edge from (10,37,5) to (11,37,6) would be V-C if V is the 11th residue in the first sequence and C is the 6th residue in the third sequence. Note that different edges in the graph can have the same label.

    The weights attached to an edge should be the 'sum of pairs' weights. Specifically, each edge is labelled by 3 characters, say x_1, x_2, x_3, which may be residues or gap characters. There are 3 different unordered pairs of these characters, namely (x_1, x_2), (x_1, x_3) and (x_2, x_3). The weight attached to the edge is then the sum of the 3 pair weights, where the weight of (x_i, x_j) is

  2. Run your program to produce an output file giving the edit graph for the following three sequences:
    >Secretion Monitor Precursor in Yersinia pestis
    MVAASLGVPLNLSGVPDHAALANTSSSQSRQNHGTTNFNSLALLHDIHRRLSFSVDYWQQHALRTVIRHLSFA
    > Secretion Monitor Precursor in Shigella flexneri
    MVAASLGLPALSNAAEPNAPAKATTRNHEPSAKVNFGQLALLEANTRRPNSNYSVDYWHQHAIRTVIRHLSFA
    > Secretion Monitor Precursor in Salmonella Typhi
    MVAASFGLPALSNAAETNTPARTTASTASKVNFSHLALLEASNRRPNFTVDYWHQHAIRTVIRHLSFA
    
    using the BLOSUM62 score matrix for the pairwise scores:
       A  R  N  D  C  Q  E  G  H  I  L  K  M  F  P  S  T  W  Y  V  B  Z  X  *
    A  4 -1 -2 -2  0 -1 -1  0 -2 -1 -1 -1 -1 -2 -1  1  0 -3 -2  0 -2 -1  0 -4 
    R -1  5  0 -2 -3  1  0 -2  0 -3 -2  2 -1 -3 -2 -1 -1 -3 -2 -3 -1  0 -1 -4 
    N -2  0  6  1 -3  0  0  0  1 -3 -3  0 -2 -3 -2  1  0 -4 -2 -3  3  0 -1 -4 
    D -2 -2  1  6 -3  0  2 -1 -1 -3 -4 -1 -3 -3 -1  0 -1 -4 -3 -3  4  1 -1 -4 
    C  0 -3 -3 -3  9 -3 -4 -3 -3 -1 -1 -3 -1 -2 -3 -1 -1 -2 -2 -1 -3 -3 -2 -4 
    Q -1  1  0  0 -3  5  2 -2  0 -3 -2  1  0 -3 -1  0 -1 -2 -1 -2  0  3 -1 -4 
    E -1  0  0  2 -4  2  5 -2  0 -3 -3  1 -2 -3 -1  0 -1 -3 -2 -2  1  4 -1 -4 
    G  0 -2  0 -1 -3 -2 -2  6 -2 -4 -4 -2 -3 -3 -2  0 -2 -2 -3 -3 -1 -2 -1 -4 
    H -2  0  1 -1 -3  0  0 -2  8 -3 -3 -1 -2 -1 -2 -1 -2 -2  2 -3  0  0 -1 -4 
    I -1 -3 -3 -3 -1 -3 -3 -4 -3  4  2 -3  1  0 -3 -2 -1 -3 -1  3 -3 -3 -1 -4 
    L -1 -2 -3 -4 -1 -2 -3 -4 -3  2  4 -2  2  0 -3 -2 -1 -2 -1  1 -4 -3 -1 -4 
    K -1  2  0 -1 -3  1  1 -2 -1 -3 -2  5 -1 -3 -1  0 -1 -3 -2 -2  0  1 -1 -4 
    M -1 -1 -2 -3 -1  0 -2 -3 -2  1  2 -1  5  0 -2 -1 -1 -1 -1  1 -3 -1 -1 -4 
    F -2 -3 -3 -3 -2 -3 -3 -3 -1  0  0 -3  0  6 -4 -2 -2  1  3 -1 -3 -3 -1 -4 
    P -1 -2 -2 -1 -3 -1 -1 -2 -2 -3 -3 -1 -2 -4  7 -1 -1 -4 -3 -2 -2 -1 -2 -4 
    S  1 -1  1  0 -1  0  0  0 -1 -2 -2  0 -1 -2 -1  4  1 -3 -2 -2  0  0  0 -4 
    T  0 -1  0 -1 -1 -1 -1 -2 -2 -1 -1 -1 -1 -2 -1  1  5 -2 -2  0 -1 -1  0 -4 
    W -3 -3 -4 -4 -2 -2 -3 -2 -2 -3 -2 -3 -1  1 -4 -3 -2 11  2 -3 -4 -3 -2 -4 
    Y -2 -2 -2 -3 -2 -1 -2 -3  2 -1 -1 -2 -1  3 -3 -2 -2  2  7 -1 -3 -2 -1 -4 
    V  0 -3 -3 -3 -1 -2 -2 -3 -3  3  1 -2  1 -1 -2 -2  0 -3 -1  4 -3 -2 -1 -4 
    B -2 -1  3  4 -3  0  1 -1  0 -3 -4  0 -3 -3 -2  0 -1 -4 -3 -3  4  1 -1 -4 
    Z -1  0  0  1 -3  3  4 -2  0 -3 -3  1 -1 -3 -1  0 -1 -3 -2 -2  1  4 -1 -4 
    X  0 -1 -1 -1 -2 -1 -1 -1 -1 -1 -1 -1 -1 -1 -2  0  0 -2 -1 -1 -1 -1 -1 -4 
    * -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4 -4  1 
    
    Gap penalty: -6
    
    Then run your WDAG program from homework # 2 on this file to produce a highest scoring path (and its score) giving a highest-scoring alignment of the three sequences. You should adjust the program output such that each of the edge labels (corresponding to an aligned column of residues) appears on a separate line.
  3. You must turn in your results and your computer program, using the template (file format) described below. Please put everything into ONE plain text file - do not send an archive of files or a tar file, or a word processing document file. Compress it (using either Unix compress, or gzip -- if you don't have access to either of these programs let us know), and send it as an attachment to both Phil and Aaron.
Here is the template: <gs540_hw assignment='3' name='student name' email='student email'> <results> <result type='part1' file='filename'> <firstline> This line can be left blank. </firstline> <edgeweights> Weights associated with each edge label (not each edge!) in the graph. Put a newline between different edge labels. For example: AAA = 1.0 AAC = 1.1 </edgeweights> <edgehistogram> Histogram showing the number of occurrences of each edge label in the graph. Looks like edgeweights, except numbers must be non-negative integers. </edgehistogram> <score> Put the score of the highest scoring path in the graph here. </score> <beginningvertex> Starting vertex label. </beginningvertex> <endingvertex> Ending vertex label. </endingvertex> <path> Put the output of the multiple alignment code here. The edge labels of the alignment graph should be put here one edge label per line. For example: AAA AAC AAT </path> </result> </results> <program> <comments> Put comments about your code here. </comments> <file> Program file contents here. </file> </program> </gs540_hw>